🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TGFA

DescriptionProtransforming growth factor alpha

Gene and Protein Information

Gene ID7039
Uniprot Accession IDs P01135 A8K286 Q15577 Q53SK7 Q9BS56 Q9UEI3 Q9UKM1 Q9UKM2 Q9UKM3
Ensembl ID ENSP00000295400
Symbol TFGA
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp737080TGFAtransforming growth factor alpha9598VGNC:479OMA, EggNOG
Macaque613031TGFAtransforming growth factor alpha9544Inparanoid, OMA, EggNOG
Mouse21802Tgfatransforming growth factor alpha10090MGI:98724Inparanoid, OMA, EggNOG
Rat24827Tgfatransforming growth factor alpha10116RGD:3849Inparanoid, OMA, EggNOG
Horse100060423TGFAtransforming growth factor alpha9796VGNC:51415Inparanoid, OMA, EggNOG
CowTGFAtransforming growth factor alpha [Source:HGNC Symbol;Acc:HGNC:11765]9913OMA, EggNOG
Pig397484TGFAtransforming growth factor alpha9823Inparanoid, OMA, EggNOG
Opossum100032790TGFAtransforming growth factor alpha13616Inparanoid, EggNOG
Xenopus100485434tgfatransforming growth factor alpha8364XB-GENE-852694Inparanoid, OMA, EggNOG
Zebrafish100034402tgfatransforming growth factor, alpha7955ZDB-GENE-040724-208Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Protransforming growth factor alpha
DTO Classes
protein    /    Signaling    /    Growth factor    /    Protransforming growth factor alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.