TIA1

DescriptionNucleolysin TIA-1 isoform p40

Gene and Protein Information

Gene ID7072
Uniprot Accession IDs P31483 Q53SS9 Q96B58
Ensembl ID ENSP00000401371
Symbol WDM TIA-1
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459303TIA1TIA1 cytotoxic granule associated RNA binding protein9598OMA, EggNOG
Macaque702366TIA1TIA1 cytotoxic granule associated RNA binding protein9544Inparanoid, OMA, EggNOG
Mouse21841Tia1cytotoxic granule-associated RNA binding protein 110090MGI:107914Inparanoid, OMA, EggNOG
Rat312510Tia1TIA1 cytotoxic granule-associated RNA binding protein10116RGD:1305742Inparanoid, OMA
Dog610625TIA1TIA1 cytotoxic granule associated RNA binding protein9615VGNC:47363Inparanoid, OMA, EggNOG
HorseTIA1TIA1 cytotoxic granule associated RNA binding protein [Source:HGNC Symbol;Acc:HGNC:11802]9796OMA, EggNOG
Cow538533TIA1TIA1 cytotoxic granule associated RNA binding protein9913VGNC:35858Inparanoid, OMA, EggNOG
Opossum100032808TIA1TIA1 cytotoxic granule associated RNA binding protein13616Inparanoid, EggNOG
Chicken771327TIA1TIA1 cytotoxic granule associated RNA binding protein9031Inparanoid, OMA, EggNOG
Xenopus394890tia1TIA1 cytotoxic granule-associated RNA binding protein8364XB-GENE-1002876Inparanoid, OMA, EggNOG
Zebrafish793165tia1TIA1 cytotoxic granule-associated RNA binding protein7955ZDB-GENE-030131-1506Inparanoid, OMA, EggNOG
C. elegans173967tiar-1TIA-1/TIAL RNA binding protein homolog6239OMA, EggNOG
S.cerevisiae855716PUB1Pub1p4932S000004961OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.