🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ATG10

DescriptionUbiquitin-like-conjugating enzyme ATG10

Gene and Protein Information

Gene ID83734
Uniprot Accession IDs Q9H0Y0 B2RE09 Q6PIX1 Q9H842
Ensembl ID ENSP00000282185
Symbol APG10L APG10 APG10L pp12616
FamilyBelongs to the ATG10 family.
Sequence
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461768ATG10autophagy related 109598VGNC:3907OMA, EggNOG
Macaque711835ATG10autophagy related 109544Inparanoid, OMA, EggNOG
Mouse66795Atg10autophagy related 1010090MGI:1914045Inparanoid, OMA, EggNOG
Rat688555Atg10autophagy related 1010116RGD:1587624Inparanoid, OMA, EggNOG
Dog610103ATG10autophagy related 109615VGNC:38214Inparanoid, OMA, EggNOG
Horse100073249ATG10autophagy related 109796VGNC:15615Inparanoid, OMA, EggNOG
Cow787344ATG10autophagy related 109913VGNC:26248OMA, EggNOG
Opossum100015423ATG10autophagy related 1013616Inparanoid, OMA, EggNOG
Chicken427322ATG10autophagy related 109031CGNC:14227Inparanoid, OMA
Zebrafish641330atg10ATG10 autophagy related 10 homolog (S. cerevisiae)7955ZDB-GENE-051030-72Inparanoid, OMA
C. elegans183959atg-10AuTophaGy (yeast Atg homolog)6239Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.