🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ATG4A

DescriptionCysteine protease ATG4A

Gene and Protein Information

Gene ID115201
Uniprot Accession IDs Q8WYN0 A6NCH2 B2RAZ7 D3DUY0 O95534 Q5JYY9 Q5JYZ0 Q86VE5 Q96KQ0 Q96KQ1
Ensembl ID ENSP00000361306
Symbol APG4A AUTL2 APG4A AUTL2
FamilyBelongs to the peptidase C54 family.
Sequence
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp473725ATG4Aautophagy related 4A cysteine peptidase9598VGNC:7792Inparanoid, OMA, EggNOG
Macaque703367ATG4Aautophagy related 4A cysteine peptidase9544Inparanoid, OMA
Mouse666468Atg4aautophagy related 4A, cysteine peptidase10090MGI:2147903Inparanoid, OMA, EggNOG
Dog481015ATG4Aautophagy related 4A cysteine peptidase9615VGNC:38223Inparanoid, OMA, EggNOG
Horse100060165ATG4Aautophagy related 4A cysteine peptidase9796VGNC:15623Inparanoid, OMA, EggNOG
Cow408003ATG4Aautophagy related 4A cysteine peptidase9913VGNC:26257Inparanoid, OMA, EggNOG
Pig100156732ATG4Aautophagy related 4A cysteine peptidase9823OMA, EggNOG
OpossumATG4Aautophagy related 4A cysteine peptidase [Source:HGNC Symbol;Acc:HGNC:16489]13616Inparanoid, OMA, EggNOG
Platypus100077214ATG4Aautophagy related 4A cysteine peptidase9258Inparanoid, OMA, EggNOG
Chicken772074ATG4Aautophagy related 4A cysteine peptidase9031CGNC:6275Inparanoid, OMA, EggNOG
Anole lizard100564533atg4aautophagy related 4A cysteine peptidase28377Inparanoid, OMA
Xenopus549373atg4aautophagy related 4A cysteine peptidase8364XB-GENE-922674Inparanoid, OMA, EggNOG
Zebrafish554140atg4aautophagy related 4A, cysteine peptidase7955ZDB-GENE-050522-430Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.