224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Apolipoprotein C-I |
|---|
Gene and Protein Information
| Gene ID | 341 |
|---|---|
| Uniprot Accession IDs | P02654 B2R526 Q6IB97 Apo-CI |
| Ensembl ID | ENSP00000465356 |
| Symbol | Apo-CI ApoC-I apo-CIB apoC-IB |
| Family | Belongs to the apolipoprotein C1 family. |
| Sequence | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743864 | APOC1 | apolipoprotein C1 | 9598 | VGNC:10193 | Inparanoid, OMA |
| Mouse | 11812 | Apoc1 | apolipoprotein C-I | 10090 | MGI:88053 | Inparanoid, OMA |
| Dog | 476437 | APOC1 | apolipoprotein C1 | 9615 | VGNC:37999 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.