224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | C-type lectin domain family 4 member K |
|---|
Gene and Protein Information
| Gene ID | 50489 |
|---|---|
| Uniprot Accession IDs | Q9UJ71 |
| Ensembl ID | ENSP00000386378 |
| Symbol | CLEC4K CLEC4K |
| Sequence | MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737419 | CD207 | CD207 molecule | 9598 | VGNC:187 | OMA, EggNOG |
| Macaque | 703420 | CD207 | CD207 molecule | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 246278 | Cd207 | CD207 antigen | 10090 | MGI:2180021 | Inparanoid, OMA, EggNOG |
| Rat | 502852 | Cd207 | CD207 molecule | 10116 | RGD:1565913 | Inparanoid, OMA, EggNOG |
| Dog | 612679 | CD207 | CD207 molecule | 9615 | VGNC:54285 | Inparanoid, OMA, EggNOG |
| Horse | 100060253 | CD207 | CD207 molecule | 9796 | VGNC:16251 | Inparanoid, OMA, EggNOG |
| Cow | 511000 | CD207 | CD207 molecule | 9913 | VGNC:27011 | Inparanoid, OMA |
| Pig | 100037935 | CD207 | CD207 molecule | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025785 | CD207 | CD207 molecule | 13616 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / cell adhesion molecule / C-type lectin domain family 4 member K
protein / receptor / immunoglobulin receptor superfamily / C-type lectin domain family 4 member K
protein / receptor / defense/immunity protein / C-type lectin domain family 4 member K
protein / receptor / cytokine receptor / C-type lectin domain family 4 member K
protein / receptor / cell adhesion molecule / C-type lectin domain family 4 member K
protein / receptor / immunoglobulin receptor superfamily / C-type lectin domain family 4 member K
protein / receptor / defense/immunity protein / C-type lectin domain family 4 member K
protein / receptor / cytokine receptor / C-type lectin domain family 4 member K
DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / C-type lectin domain family 4 member K
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / C-type lectin domain family 4 member K
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.