🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CLEC6A

DescriptionC-type lectin domain family 6 member A

Gene and Protein Information

Gene ID93978
Uniprot Accession IDs Q6EIG7 A2RUK3
Ensembl ID ENSP00000371505
Symbol CLECSF10 DECTIN2 CLEC4N CLECSF10 dectin-2
Sequence
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp735479CLEC6AC-type lectin domain containing 6A9598VGNC:8378OMA, EggNOG
Macaque716162CLEC6AC-type lectin domain containing 6A9544Inparanoid, OMA, EggNOG
Mouse56620Clec4nC-type lectin domain family 4, member n10090MGI:1861231Inparanoid, OMA
Cow514979CLEC6AC-type lectin domain containing 6A9913VGNC:27436Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    cell adhesion molecule    /    C-type lectin domain family 6 member A
protein    /    receptor    /    immunoglobulin receptor superfamily    /    C-type lectin domain family 6 member A
protein    /    receptor    /    defense/immunity protein    /    C-type lectin domain family 6 member A
protein    /    receptor    /    cytokine receptor    /    C-type lectin domain family 6 member A
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    C-type lectin domain family 6 member A

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.