ATP5PD

DescriptionATP synthase subunit d, mitochondrial

Gene and Protein Information

Gene ID10476
Uniprot Accession IDs O75947 B2R5L6 Q9H3J4 ATPase subunit d
Ensembl ID ENSP00000301587
Symbol ATP5H ATPQ APT5H ATP5H
FamilyBelongs to the ATPase d subunit family.
Sequence
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736468ATP5PDATP synthase peripheral stalk subunit d9598VGNC:9225OMA, EggNOG
Macaque700338ATP5PDATP synthase peripheral stalk subunit d9544OMA, EggNOG
Horse100052170ATP5PDATP synthase peripheral stalk subunit d9796VGNC:15662OMA, EggNOG
Cow282710ATP5PDATP synthase peripheral stalk subunit d9913Inparanoid, OMA, EggNOG
Opossum100023278ATP5PDATP synthase peripheral stalk subunit d13616OMA, EggNOG
Platypus100085769ATP5PDATP synthase peripheral stalk subunit d9258OMA, EggNOG
Chicken422115ATP5HATP synthase, H+ transporting, mitochondrial Fo complex subunit D9031CGNC:5993Inparanoid, OMA, EggNOG
Anole lizard100565813atp5pdATP synthase peripheral stalk subunit d28377OMA, EggNOG
Xenopus496430atp5pdATP synthase peripheral stalk subunit d8364XB-GENE-993879OMA, EggNOG
Fruitfly42291ATPsynDATP synthase, subunit D7227FBgn0016120Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    F-type and V-type ATPases    /    F-type ATPase    /    ATP synthase subunit d, mitochondrial

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.