224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | ADP-ribosylation factor 5 |
|---|
Gene and Protein Information
| Gene ID | 381 |
|---|---|
| Uniprot Accession IDs | P84085 P26437 |
| Ensembl ID | ENSP00000000233 |
| Family | Belongs to the small GTPase superfamily. Arf family. |
| Sequence | MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 11844 | Arf5 | ADP-ribosylation factor 5 | 10090 | MGI:99434 | Inparanoid, OMA |
| Rat | 79117 | Arf5 | ADP-ribosylation factor 5 | 10116 | RGD:621278 | Inparanoid, OMA |
| Horse | 100056654 | ARF5 | ADP ribosylation factor 5 | 9796 | VGNC:15445 | Inparanoid, OMA |
| Cow | 511918 | ARF5 | ADP ribosylation factor 5 | 9913 | VGNC:26060 | Inparanoid, OMA |
| Pig | 100270722 | ARF5 | ADP ribosylation factor 5 | 9823 | Inparanoid, OMA | |
| Opossum | 100014430 | ARF5 | ADP ribosylation factor 5 | 13616 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.