🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ASH2L

DescriptionSet1/Ash2 histone methyltransferase complex subunit ASH2

Gene and Protein Information

Gene ID9070
Uniprot Accession IDs Q9UBL3 A8K7C3 D3DSW9 O60659 O60660 Q96B62
Ensembl ID ENSP00000340896
Symbol ASH2L1 ASH2 Bre2 ASH2L1 ASH2L2
Sequence
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464115ASH2LASH2 like, histone lysine methyltransferase complex subunit9598VGNC:10321OMA, EggNOG
Macaque699382ASH2LASH2 like histone lysine methyltransferase complex subunit9544Inparanoid, OMA, EggNOG
Mouse23808Ash2lASH2 like histone lysine methyltransferase complex subunit10090MGI:1344416Inparanoid, OMA, EggNOG
Rat290829Ash2lASH2 like histone lysine methyltransferase complex subunit10116RGD:1305632Inparanoid, OMA, EggNOG
Dog475589ASH2LASH2 like, histone lysine methyltransferase complex subunit9615VGNC:50623Inparanoid, OMA, EggNOG
Horse100059465ASH2LASH2 like, histone lysine methyltransferase complex subunit9796VGNC:50586Inparanoid, OMA, EggNOG
Cow100138350ASH2LASH2 like, histone lysine methyltransferase complex subunit9913VGNC:49156Inparanoid, OMA, EggNOG
Pig100627423ASH2LASH2 like histone lysine methyltransferase complex subunit9823Inparanoid, OMA, EggNOG
Opossum100029781ASH2LASH2 like histone lysine methyltransferase complex subunit13616Inparanoid, EggNOG
Chicken426774ASH2LASH2 like histone lysine methyltransferase complex subunit9031CGNC:2347Inparanoid, OMA, EggNOG
Anole lizard100554381ash2lASH2 like histone lysine methyltransferase complex subunit28377Inparanoid, OMA, EggNOG
Xenopus100492052ash2lASH2 like, histone lysine methyltransferase complex subunit8364XB-GENE-923264Inparanoid, OMA, EggNOG
Zebrafish558193ash2lash2 like, histone lysine methyltransferase complex subunit7955ZDB-GENE-030131-494Inparanoid, OMA, EggNOG
C. elegans174838ash-2ASH histone methyltransferase complex subunit (Drosophila absent, small or homeotic discs)6239Inparanoid, OMA, EggNOG
Fruitfly42936ash2absent, small, or homeotic discs 27227FBgn0000139Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Set1/Ash2 histone methyltransferase complex subunit ASH2
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Set1/Ash2 histone methyltransferase complex subunit ASH2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.