🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ATP1B3

DescriptionSodium/potassium-transporting ATPase subunit beta-3

Gene and Protein Information

Gene ID483
Uniprot Accession IDs P54709 B7Z1N7
Ensembl ID ENSP00000286371
Symbol CD298 ATPB-3
FamilyBelongs to the X(+)/potassium ATPases subunit beta family.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746692ATP1B3ATPase Na+/K+ transporting subunit beta 39598VGNC:7958OMA, EggNOG
Mouse11933Atp1b3ATPase, Na+/K+ transporting, beta 3 polypeptide10090MGI:107788Inparanoid, OMA, EggNOG
Rat25390Atp1b3ATPase Na+/K+ transporting subunit beta 310116RGD:2172Inparanoid, OMA, EggNOG
Dog477098ATP1B3ATPase Na+/K+ transporting subunit beta 39615VGNC:38250Inparanoid, OMA, EggNOG
Horse100062895ATP1B3ATPase Na+/K+ transporting subunit beta 39796VGNC:15647Inparanoid, OMA, EggNOG
Cow532844ATP1B3ATPase Na+/K+ transporting subunit beta 39913VGNC:26287Inparanoid, OMA, EggNOG
Pig100514493ATP1B3ATPase Na+/K+ transporting subunit beta 39823Inparanoid, OMA
Chicken396549ATP1B3ATPase Na+/K+ transporting subunit beta 39031CGNC:1995Inparanoid, OMA
Anole lizard100556957atp1b3ATPase Na+/K+ transporting subunit beta 328377Inparanoid, OMA
Xenopus394687atp1b3ATPase Na+/K+ transporting subunit beta 38364XB-GENE-485127Inparanoid, OMA
Zebrafish64272atp1b3bATPase Na+/K+ transporting subunit beta 3b7955ZDB-GENE-001127-1Inparanoid, OMA
C. elegans182726nkb-1Sodium/potassium-transporting ATPase subunit beta-16239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Sodium/potassium-transporting ATPase subunit beta-3
DTO Classes
protein    /    Transporter    /    P-type ATPases    /    Na+/K+-ATPases    /    Sodium/potassium-transporting ATPase subunit beta-3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.