224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Charged multivesicular body protein 3 |
|---|
Gene and Protein Information
| Gene ID | 100526767 |
|---|---|
| Uniprot Accession IDs | Q9Y3E7 A8K3W0 B4DG34 B8ZZM0 B8ZZX5 Q3ZTS9 Q53S71 Q53SU5 Q9NZ51 |
| Ensembl ID | ENSP00000474823 |
| Symbol | CGI149 NEDF VPS24 NEDF CHMP3 VPS24 CGI149 hVps24 RNF103-VPS24 |
| Family | Belongs to the SNF7 family. |
| Sequence | MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.