🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ATG12

DescriptionUbiquitin-like protein ATG12

Gene and Protein Information

Gene ID9140
Uniprot Accession IDs O94817 Q6PJV2
Ensembl ID ENSP00000425107
Symbol APG12 APG12L APG12 FBR93 APG12L HAPG12
FamilyBelongs to the ATG12 family.
Sequence
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp462011ATG12autophagy related 129598VGNC:11833OMA, EggNOG
Mouse67526Atg12autophagy related 1210090MGI:1914776Inparanoid, OMA, EggNOG
Rat361321Atg12autophagy related 1210116RGD:1306306Inparanoid, OMA
Dog474636ATG12autophagy related 129615VGNC:38216Inparanoid, OMA, EggNOG
Horse100073160ATG12autophagy related 129796VGNC:15617Inparanoid, OMA, EggNOG
Cow767903ATG12autophagy related 129913VGNC:26250Inparanoid, OMA, EggNOG
Opossum100029238ATG12autophagy related 1213616Inparanoid, OMA, EggNOG
Chicken427390ATG12autophagy related 129031CGNC:1672Inparanoid, OMA, EggNOG
Anole lizard100556912atg12autophagy related 1228377Inparanoid, OMA, EggNOG
Xenopus100493403atg12autophagy related 128364XB-GENE-5730378Inparanoid, OMA, EggNOG
Zebrafish570965atg12ATG12 autophagy related 12 homolog (S. cerevisiae)7955ZDB-GENE-071205-7Inparanoid, OMA, EggNOG
C. elegans175793lgg-3Ubiquitin-like protein ATG126239Inparanoid, OMA, EggNOG
Fruitfly39383Atg12Autophagy-related 127227FBgn0036255Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.