🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ARPC2

DescriptionActin-related protein 2/3 complex subunit 2

Gene and Protein Information

Gene ID10109
Uniprot Accession IDs O15144 Q92801 Q9P1D4
Ensembl ID ENSP00000295685
Symbol ARC34 ARC34 PRO2446 p34-Arc PNAS-139
FamilyBelongs to the ARPC2 family.
Sequence
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp459938ARPC2actin related protein 2/3 complex subunit 29598VGNC:90OMA, EggNOG
Macaque700536ARPC2actin related protein 2/3 complex subunit 29544Inparanoid, OMA, EggNOG
Mouse76709Arpc2actin related protein 2/3 complex, subunit 210090MGI:1923959Inparanoid, OMA, EggNOG
Rat301511Arpc2actin related protein 2/3 complex, subunit 210116RGD:1305848Inparanoid, OMA
Horse100058331ARPC2actin related protein 2/3 complex subunit 29796VGNC:15537Inparanoid, OMA, EggNOG
Cow540838ARPC2actin related protein 2/3 complex subunit 29913Inparanoid, OMA, EggNOG
Pig100153175ARPC2actin related protein 2/3 complex subunit 29823Inparanoid, OMA, EggNOG
Opossum100011642ARPC2actin related protein 2/3 complex subunit 213616Inparanoid, OMA, EggNOG
Chicken429041ARPC2actin related protein 2/3 complex subunit 29031Inparanoid, OMA, EggNOG
Anole lizard100566658arpc2actin related protein 2/3 complex subunit 228377Inparanoid, OMA, EggNOG
Xenopus448094arpc2actin related protein 2/3 complex subunit 28364XB-GENE-491571Inparanoid, OMA, EggNOG
Zebrafish327068arpc2actin related protein 2/3 complex, subunit 27955ZDB-GENE-030131-5276Inparanoid, OMA, EggNOG
C. elegans175247arx-4Probable actin-related protein 2/3 complex subunit 26239Inparanoid, OMA
Fruitfly35311Arpc2Actin-related protein 2/3 complex, subunit 27227FBgn0032859Inparanoid, EggNOG
S.cerevisiae855771ARC35Arc35p4932S000005318Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.