224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Beta-arrestin-1 |
|---|
Gene and Protein Information
| Gene ID | 408 |
|---|---|
| Uniprot Accession IDs | P49407 B6V9G8 O75625 O75630 Q2PP20 Q9BTK8 |
| Ensembl ID | ENSP00000409581 |
| Symbol | ARR1 ARB1 ARR1 |
| Family | Belongs to the arrestin family. |
| Sequence | MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451424 | ARRB1 | arrestin beta 1 | 9598 | VGNC:11261 | OMA, EggNOG |
| Macaque | 695250 | ARRB1 | arrestin beta 1 | 9544 | OMA, EggNOG | |
| Mouse | 109689 | Arrb1 | arrestin, beta 1 | 10090 | MGI:99473 | Inparanoid, OMA, EggNOG |
| Rat | 25387 | Arrb1 | arrestin, beta 1 | 10116 | RGD:2156 | Inparanoid, OMA, EggNOG |
| Dog | 485189 | ARRB1 | arrestin beta 1 | 9615 | VGNC:38136 | Inparanoid, OMA |
| Horse | 100064657 | ARRB1 | arrestin beta 1 | 9796 | VGNC:15543 | Inparanoid, OMA |
| Cow | 281637 | ARRB1 | arrestin beta 1 | 9913 | VGNC:26169 | Inparanoid, OMA |
| Pig | 100521141 | ARRB1 | arrestin beta 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100012179 | ARRB1 | arrestin beta 1 | 13616 | Inparanoid, OMA | |
| Xenopus | 100486349 | arrb1 | arrestin beta 1 | 8364 | XB-GENE-481578 | Inparanoid, OMA |
| Zebrafish | 553266 | arrb1 | arrestin, beta 1 | 7955 | ZDB-GENE-060824-1 | Inparanoid, OMA |
| C. elegans | 180446 | arr-1 | Probable beta-arrestin | 6239 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.