224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | CDK5 regulatory subunit-associated protein 3 |
|---|
Gene and Protein Information
| Gene ID | 80279 |
|---|---|
| Uniprot Accession IDs | Q96JB5 B7Z6N4 D3DTU1 D3DTU2 F5H3I5 Q53FA2 Q9H3F8 Q9H8G0 Q9HBR9 |
| Ensembl ID | ENSP00000438886 |
| Symbol | IC53 LZAP C53 IC53 LZAP HSF-27 MST016 PP1553 OK/SW-cl.114 |
| Family | Belongs to the CDK5RAP3 family. |
| Sequence | MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455182 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9598 | VGNC:9228 | OMA, EggNOG |
| Macaque | 695189 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 80280 | Cdk5rap3 | CDK5 regulatory subunit associated protein 3 | 10090 | MGI:1933126 | Inparanoid, OMA, EggNOG |
| Rat | 80278 | Cdk5rap3 | CDK5 regulatory subunit associated protein 3 | 10116 | RGD:620002 | Inparanoid, OMA, EggNOG |
| Dog | 480541 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9615 | VGNC:39059 | Inparanoid, OMA, EggNOG |
| Horse | 100069268 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9796 | VGNC:16353 | Inparanoid, OMA, EggNOG |
| Cow | 509255 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9913 | VGNC:27132 | Inparanoid, OMA, EggNOG |
| Pig | 100521291 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 9823 | OMA, EggNOG | |
| Opossum | 100020098 | CDK5RAP3 | CDK5 regulatory subunit associated protein 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100559136 | cdk5rap3 | CDK5 regulatory subunit associated protein 3 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496928 | cdk5rap3 | CDK5 regulatory subunit associated protein 3 | 8364 | XB-GENE-1005961 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415195 | cdk5rap3 | CDK5 regulatory subunit associated protein 3 | 7955 | ZDB-GENE-040625-90 | Inparanoid, OMA, EggNOG |
| C. elegans | 180327 | cdkr-3 | CDK5RAP3-like protein | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 246534 | CG30291 | CG30291 gene product from transcript CG30291-RA | 7227 | FBgn0050291 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.