🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ARPC5

DescriptionActin-related protein 2/3 complex subunit 5

Gene and Protein Information

Gene ID10092
Uniprot Accession IDs O15511 A6NEC4 Q6PG42
Ensembl ID ENSP00000294742
Symbol ARC16 ARC16 p16-Arc dJ127C7.3
FamilyBelongs to the ARPC5 family.
Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457574ARPC5actin related protein 2/3 complex subunit 59598VGNC:6725Inparanoid, OMA, EggNOG
Mouse67771Arpc5actin related protein 2/3 complex, subunit 510090MGI:1915021Inparanoid, OMA, EggNOG
Rat360854Arpc5actin related protein 2/3 complex, subunit 510116RGD:1311791Inparanoid, OMA, EggNOG
Dog480037ARPC5actin related protein 2/3 complex subunit 59615VGNC:53328OMA, EggNOG
Horse100051848ARPC5actin related protein 2/3 complex subunit 59796VGNC:15539Inparanoid, OMA, EggNOG
Cow614345ARPC5actin related protein 2/3 complex subunit 59913VGNC:26165Inparanoid, OMA, EggNOG
Pig100174965ARPC5actin related protein 2/3 complex subunit 59823Inparanoid, OMA, EggNOG
Opossum100018488ARPC5actin related protein 2/3 complex subunit 513616Inparanoid, OMA, EggNOG
Platypus100081992ARPC5actin related protein 2/3 complex subunit 59258Inparanoid, OMA, EggNOG
Chicken429075ARPC5actin related protein 2/3 complex subunit 59031CGNC:14362Inparanoid, OMA, EggNOG
Anole lizard100555639LOC100555639actin-related protein 2/3 complex subunit 528377OMA, EggNOG
Xenopus549996arpc5actin related protein 2/3 complex subunit 58364XB-GENE-494089Inparanoid, OMA, EggNOG
Zebrafish399482arpc5bactin related protein 2/3 complex, subunit 5B7955ZDB-GENE-040120-7Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5
DTO Classes
protein    /    Cellular structure    /    Actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.