224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Artemin |
|---|
Gene and Protein Information
| Gene ID | 9048 |
|---|---|
| Uniprot Accession IDs | Q5T4W7 D3DPY1 D3DPY3 O95441 O96030 Q6P6A3 |
| Ensembl ID | ENSP00000387435 |
| Symbol | EVN ART EVN NBN ENOVIN |
| Family | Belongs to the TGF-beta family. GDNF subfamily. |
| Sequence | MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469310 | ARTN | artemin | 9598 | VGNC:445 | OMA, EggNOG |
| Macaque | 701641 | ARTN | artemin | 9544 | Inparanoid, OMA | |
| Mouse | 11876 | Artn | artemin | 10090 | MGI:1333791 | Inparanoid, OMA, EggNOG |
| Rat | 362572 | Artn | artemin | 10116 | RGD:621427 | Inparanoid, OMA, EggNOG |
| Cow | 530812 | ARTN | artemin | 9913 | VGNC:26181 | Inparanoid, OMA, EggNOG |
| Opossum | 100025378 | ARTN | artemin | 13616 | Inparanoid, EggNOG | |
| Anole lizard | ARTN | artemin [Source:HGNC Symbol;Acc:HGNC:727] | 28377 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.