224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Angiopoietin-related protein 3 |
|---|
Gene and Protein Information
| Gene ID | 27329 |
|---|---|
| Uniprot Accession IDs | Q9Y5C1 A0JLS0 B1ALJ0 B2RCW1 |
| Ensembl ID | ENSP00000360170 |
| Symbol | ANGPT5 ANL3 ANG-5 FHBL2 ANGPT5 |
| Sequence | MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742370 | ANGPTL3 | angiopoietin like 3 | 9598 | VGNC:86 | OMA, EggNOG |
| Mouse | 30924 | Angptl3 | angiopoietin-like 3 | 10090 | MGI:1353627 | Inparanoid, OMA, EggNOG |
| Rat | 502970 | Angptl3 | angiopoietin-like 3 | 10116 | RGD:1564505 | Inparanoid, OMA |
| Dog | 102152922 | ANGPTL3 | angiopoietin like 3 | 9615 | VGNC:37859 | Inparanoid, OMA, EggNOG |
| Horse | 100054159 | ANGPTL3 | angiopoietin like 3 | 9796 | VGNC:15302 | Inparanoid, OMA, EggNOG |
| Cow | 782603 | ANGPTL3 | angiopoietin like 3 | 9913 | VGNC:25892 | Inparanoid, OMA, EggNOG |
| Pig | 445466 | ANGPTL3 | angiopoietin like 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100616799 | ANGPTL3 | angiopoietin like 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 100189558 | ANGPTL3 | angiopoietin like 3 | 9031 | CGNC:8342 | Inparanoid, OMA |
| Xenopus | angptl3 | angiopoietin like 3 [Source:Xenbase;Acc:XB-GENE-6258790] | 8364 | OMA, EggNOG | ||
| Zebrafish | 114421 | angptl3 | angiopoietin-like 3 | 7955 | ZDB-GENE-010817-3 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.