224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Arginase-1 |
|---|
Gene and Protein Information
| Gene ID | 383 |
|---|---|
| Uniprot Accession IDs | P05089 A6NEA0 Q5JWT5 Q5JWT6 Q8TE72 Q9BS50 |
| Ensembl ID | ENSP00000349446 |
| Family | Belongs to the arginase family. |
| Sequence | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462999 | ARG1 | arginase 1 | 9598 | VGNC:11033 | OMA, EggNOG |
| Macaque | 710410 | ARG1 | arginase 1 | 9544 | Inparanoid, OMA | |
| Mouse | 11846 | Arg1 | arginase, liver | 10090 | MGI:88070 | Inparanoid, OMA, EggNOG |
| Rat | 29221 | Arg1 | arginase 1 | 10116 | RGD:2150 | Inparanoid, OMA, EggNOG |
| Dog | 474823 | ARG1 | arginase 1 | 9615 | VGNC:38041 | Inparanoid, OMA |
| Horse | 100073086 | ARG1 | arginase 1 | 9796 | VGNC:15454 | Inparanoid, OMA |
| Cow | 513608 | ARG1 | arginase 1 | 9913 | VGNC:26070 | Inparanoid, OMA, EggNOG |
| Pig | 397115 | ARG1 | arginase 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100031015 | ARG1 | arginase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | ARG1 | arginase 1 [Source:HGNC Symbol;Acc:HGNC:663] | 9258 | OMA, EggNOG | ||
| Xenopus | 448358 | arg1 | arginase 1 | 8364 | XB-GENE-966913 | Inparanoid, OMA |
| Fruitfly | 46717 | arg | arginase | 7227 | FBgn0023535 | Inparanoid, EggNOG |
| S.cerevisiae | 855993 | CAR1 | arginase | 4932 | S000006032 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.