224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Arylamine N-acetyltransferase 1 |
|---|
Gene and Protein Information
| Gene ID | 9 |
|---|---|
| Uniprot Accession IDs | P18440 A8K4E7 O15159 O15300 Q546N1 Q96TE9 |
| Ensembl ID | ENSP00000443194 |
| Symbol | AAC1 AAC1 MNAT NATI NAT-1 |
| Family | Belongs to the arylamine N-acetyltransferase family. |
| Sequence | MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464023 | NAT1 | N-acetyltransferase 1 | 9598 | OMA, EggNOG | |
| Macaque | 704019 | LOC704019 | arylamine N-acetyltransferase 1 | 9544 | OMA, EggNOG | |
| Mouse | 17961 | Nat2 | N-acetyltransferase 2 (arylamine N-acetyltransferase) | 10090 | MGI:109201 | Inparanoid, OMA, EggNOG |
| Rat | 116632 | Nat2 | N-acetyltransferase 2 | 10116 | RGD:70492 | Inparanoid, OMA, EggNOG |
| Horse | 100049837 | LOC100049837 | arylamine N-acetyltransferase 1 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 512603 | NAT1 | N-acetyltransferase 1 (arylamine N-acetyltransferase) | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100511905 | LOC100511905 | arylamine N-acetyltransferase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077007 | LOC100077007 | arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like | 9258 | OMA, EggNOG | |
| Chicken | 415809 | PNAT3 | N-acetyltransferase, pineal gland isozyme NAT-3 | 9031 | CGNC:50088 | OMA, EggNOG |
| Anole lizard | 100565208 | LOC100565208 | arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like | 28377 | OMA, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.