224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein FAM50A |
|---|
Gene and Protein Information
| Gene ID | 9130 |
|---|---|
| Uniprot Accession IDs | Q14320 A8KAQ4 B2R997 Q5HY37 Q6PJH5 |
| Ensembl ID | ENSP00000377225 |
| Symbol | DXS9928E HXC26 XAP5 9F XAP5 HXC26 HXC-26 DXS9928E |
| Family | Belongs to the FAM50 family. |
| Sequence | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742749 | FAM50A | family with sequence similarity 50 member A | 9598 | VGNC:3761 | OMA, EggNOG |
| Mouse | 108160 | Fam50a | family with sequence similarity 50, member A | 10090 | MGI:1351626 | Inparanoid, OMA |
| Rat | 293862 | Fam50a | family with sequence similarity 50, member A | 10116 | RGD:1560964 | Inparanoid, OMA |
| Dog | 100684336 | FAM50A | family with sequence similarity 50 member A | 9615 | VGNC:40687 | Inparanoid, OMA |
| Horse | 100630700 | FAM50A | family with sequence similarity 50 member A | 9796 | VGNC:17879 | Inparanoid, OMA |
| Cow | 515539 | FAM50A | family with sequence similarity 50 member A | 9913 | VGNC:28820 | Inparanoid, OMA |
| Anole lizard | 100563063 | fam50a | family with sequence similarity 50 member A | 28377 | Inparanoid, OMA | |
| Xenopus | 734115 | fam50a | family with sequence similarity 50 member A | 8364 | XB-GENE-970297 | Inparanoid, OMA |
| Zebrafish | 550329 | fam50a | family with sequence similarity 50, member A | 7955 | ZDB-GENE-050417-110 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.