🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ARPC5L

DescriptionActin-related protein 2/3 complex subunit 5-like protein

Gene and Protein Information

Gene ID81873
Uniprot Accession IDs Q9BPX5 Q7Z523
Ensembl ID ENSP00000345361
Symbol ARC16-2
FamilyBelongs to the ARPC5 family.
Sequence
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp739553ARPC5Lactin related protein 2/3 complex subunit 5 like9598VGNC:13853OMA, EggNOG
Mouse74192Arpc5lactin related protein 2/3 complex, subunit 5-like10090MGI:1921442Inparanoid, OMA, EggNOG
Rat296710Arpc5lactin related protein 2/3 complex, subunit 5-like10116RGD:1308867Inparanoid, OMA, EggNOG
Dog612856ARPC5Lactin related protein 2/3 complex subunit 5 like9615VGNC:38132Inparanoid, OMA, EggNOG
Horse100067289ARPC5Lactin related protein 2/3 complex subunit 5 like9796VGNC:15540Inparanoid, OMA, EggNOG
Cow613421ARPC5Lactin related protein 2/3 complex subunit 5 like9913VGNC:26166Inparanoid, OMA, EggNOG
Pig100154462ARPC5Lactin related protein 2/3 complex subunit 5 like9823OMA, EggNOG
Opossum100015743ARPC5Lactin related protein 2/3 complex subunit 5 like13616Inparanoid, EggNOG
Platypus100078118ARPC5Lactin related protein 2/3 complex subunit 5 like9258OMA, EggNOG
Chicken101752218ARPC5Lactin related protein 2/3 complex subunit 5 like9031CGNC:71626OMA, EggNOG
Anole lizard100556158LOC100556158actin-related protein 2/3 complex subunit 5-like protein28377OMA, EggNOG
Xenopus734053arpc5lactin related protein 2/3 complex subunit 5-like8364XB-GENE-490524Inparanoid, OMA, EggNOG
Zebrafish393550arpc5laactin related protein 2/3 complex, subunit 5-like, a7955ZDB-GENE-040426-1453OMA, EggNOG
C. elegans171882arx-7Actin-related protein 2/3 complex subunit 56239OMA, EggNOG
C. elegans183522C46H11.3Probable actin-related protein 2/3 complex subunit 56239Inparanoid, OMA
S.cerevisiae854748ARC15Arc15p4932S000001324OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein
DTO Classes
protein    /    Cellular structure    /    Actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.