🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ARL11

DescriptionADP-ribosylation factor-like protein 11

Gene and Protein Information

Gene ID115761
Uniprot Accession IDs Q969Q4
Ensembl ID ENSP00000282026
Symbol ARLTS1 ARLTS1
FamilyBelongs to the small GTPase superfamily. Arf family.
Sequence
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp467358ARL11ADP ribosylation factor like GTPase 119598VGNC:13068OMA, EggNOG
Macaque706725ARL11ADP ribosylation factor like GTPase 119544Inparanoid, OMA, EggNOG
Mouse219144Arl11ADP-ribosylation factor-like 1110090MGI:2444054Inparanoid, OMA, EggNOG
Rat364396Arl11ADP-ribosylation factor like GTPase 1110116RGD:1308083Inparanoid, OMA, EggNOG
Horse102150556ARL11ADP ribosylation factor like GTPase 119796VGNC:15508Inparanoid, OMA, EggNOG
Cow513113ARL11ADP ribosylation factor like GTPase 119913VGNC:26137Inparanoid, OMA, EggNOG
Opossum100028600ARL11ADP ribosylation factor like GTPase 1113616Inparanoid, OMA, EggNOG
Platypus100083252ARL11ADP ribosylation factor like GTPase 119258Inparanoid, OMA, EggNOG
Chicken418869ARL11ADP ribosylation factor like GTPase 119031CGNC:15664Inparanoid, OMA, EggNOG
Xenopus100490310arl11ADP-ribosylation factor-like 118364XB-GENE-1012125OMA, EggNOG
Zebrafish324689arl11ADP-ribosylation factor-like 117955ZDB-GENE-030131-3410Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.