🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GMFB

DescriptionGlia maturation factor beta

Gene and Protein Information

Gene ID2764
Uniprot Accession IDs P60983 B2R499 P17774 Q9BS35 GMF-beta
Ensembl ID ENSP00000350757
Symbol GMF
FamilyBelongs to the actin-binding proteins ADF family. GMF subfamily.
Sequence
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743468GMFBglia maturation factor beta9598VGNC:7519OMA, EggNOG
Macaque696440GMFBglia maturation factor beta9544Inparanoid, OMA, EggNOG
Mouse63985Gmfbglia maturation factor, beta10090MGI:1927133Inparanoid, OMA, EggNOG
Rat81661Gmfbglia maturation factor, beta10116RGD:70910Inparanoid, OMA
Dog100856272GMFBglia maturation factor beta9615VGNC:41288Inparanoid, OMA
Horse100050097GMFBglia maturation factor beta9796VGNC:18404Inparanoid, OMA, EggNOG
Cow615255GMFBglia maturation factor beta9913VGNC:29434Inparanoid, OMA, EggNOG
Pig100625819GMFBglia maturation factor beta9823Inparanoid, OMA, EggNOG
Opossum100029084GMFBglia maturation factor beta13616Inparanoid, EggNOG
Chicken423560GMFBglia maturation factor beta9031CGNC:51994Inparanoid, OMA
Anole lizard100551831gmfbglia maturation factor beta28377Inparanoid, OMA, EggNOG
Xenopus549756gmfbglia maturation factor, beta8364XB-GENE-6077246Inparanoid, OMA, EggNOG
Zebrafish406384gmfbglia maturation factor, beta7955ZDB-GENE-040426-2114Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase modulator    /    Glia maturation factor beta
protein    /    enzyme modulator    /    signaling molecule    /    Glia maturation factor beta
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Glia maturation factor beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.