GPR174

DescriptionProbable G-protein coupled receptor 174

Gene and Protein Information

Gene ID84636
Uniprot Accession IDs Q9BXC1 Q2M3F7
Ensembl ID ENSP00000276077
Symbol FKSG79 GPCR17 LYPSR3
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMINLAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFLMYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLAQSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFRRRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100613557GPR174G protein-coupled receptor 1749598VGNC:12374OMA, EggNOG
Mouse213439Gpr174G protein-coupled receptor 17410090MGI:2685222Inparanoid, OMA, EggNOG
Rat302373Gpr174G protein-coupled receptor 17410116RGD:1564689Inparanoid, OMA, EggNOG
Dog100683878GPR174G protein-coupled receptor 1749615VGNC:41417Inparanoid, OMA, EggNOG
Horse100071745GPR174G protein-coupled receptor 1749796VGNC:18528Inparanoid, OMA, EggNOG
Cow781056GPR174G protein-coupled receptor 1749913VGNC:29571Inparanoid, OMA, EggNOG
Pig102160665GPR174G protein-coupled receptor 1749823OMA, EggNOG
Opossum100020404GPR174G protein-coupled receptor 17413616Inparanoid, OMA, EggNOG
PlatypusGPR174G protein-coupled receptor 174 [Source:HGNC Symbol;Acc:HGNC:30245]9258OMA, EggNOG
Chicken422146GPR174G protein-coupled receptor 1749031CGNC:3016Inparanoid, OMA, EggNOG
Anole lizard100563634gpr174G protein-coupled receptor 17428377Inparanoid, OMA, EggNOG
Xenopusgpr174G protein-coupled receptor 174 [Source:Xenbase;Acc:XB-GENE-994529]8364OMA, EggNOG
Zebrafish100151331gpr174G protein-coupled receptor 1747955ZDB-GENE-100930-1OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Probable G-protein coupled receptor 174

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.