224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Gasdermin-A |
|---|
Gene and Protein Information
| Gene ID | 284110 |
|---|---|
| Uniprot Accession IDs | Q96QA5 Q32MC5 Q86VE7 Q8N1M6 |
| Ensembl ID | ENSP00000301659 |
| Symbol | GSDM GSDM1 GSDM FKSG9 GSDM1 |
| Family | Belongs to the gasdermin family. |
| Sequence | MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQLMVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQSSLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746070 | GSDMA | gasdermin A | 9598 | VGNC:9312 | OMA, EggNOG |
| Mouse | 57911 | Gsdma | gasdermin A | 10090 | MGI:1889509 | Inparanoid, OMA, EggNOG |
| Rat | 360619 | Gsdma | gasdermin A | 10116 | RGD:1592062 | Inparanoid, OMA, EggNOG |
| Dog | 608276 | GSDMA | gasdermin A | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100054598 | GSDMA | gasdermin A | 9796 | VGNC:49300 | Inparanoid, OMA, EggNOG |
| Cow | 618583 | GSDMA | gasdermin A | 9913 | VGNC:49998 | Inparanoid, OMA, EggNOG |
| Opossum | 100016683 | LOC100016683 | gasdermin-A-like | 13616 | OMA, EggNOG | |
| Chicken | 426132 | GSDMA | gasdermin A | 9031 | CGNC:52687 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.