224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Fatty acid-binding protein, brain |
|---|
Gene and Protein Information
| Gene ID | 2173 |
|---|---|
| Uniprot Accession IDs | O15540 B2R4L1 O14951 Q6IAU7 Q9H047 |
| Ensembl ID | ENSP00000357429 |
| Symbol | BLBP FABPB MRG MRG BLBP FABPB B-FABP |
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
| Sequence | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472116 | FABP7 | fatty acid binding protein 7 | 9598 | VGNC:7176 | OMA, EggNOG |
| Mouse | 12140 | Fabp7 | fatty acid binding protein 7, brain | 10090 | MGI:101916 | Inparanoid, OMA, EggNOG |
| Rat | 80841 | Fabp7 | fatty acid binding protein 7 | 10116 | RGD:69312 | Inparanoid, OMA, EggNOG |
| Dog | 476278 | FABP7 | fatty acid binding protein 7 | 9615 | VGNC:40563 | Inparanoid, OMA, EggNOG |
| Horse | 100067280 | FABP7 | fatty acid binding protein 7 | 9796 | VGNC:17770 | Inparanoid, OMA, EggNOG |
| Cow | 777787 | FABP7 | fatty acid binding protein 7 | 9913 | VGNC:28699 | Inparanoid, OMA, EggNOG |
| Pig | 574075 | FABP7 | fatty acid binding protein 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100023891 | FABP7 | fatty acid binding protein 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100562795 | fabp7 | fatty acid binding protein 7 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548661 | fabp7 | fatty acid binding protein 7, brain | 8364 | XB-GENE-967704 | Inparanoid, OMA, EggNOG |
| Zebrafish | 407736 | fabp7b | fatty acid binding protein 7, brain, b | 7955 | ZDB-GENE-040614-4 | OMA, EggNOG |
| Zebrafish | 58128 | fabp7a | fatty acid binding protein 7, brain, a | 7955 | ZDB-GENE-000627-1 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.