🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GDI2

DescriptionRab GDP dissociation inhibitor beta

Gene and Protein Information

Gene ID2665
Uniprot Accession IDs P50395 O43928 Q5SX88 Q9UQM6 Rab GDI beta
Ensembl ID ENSP00000369538
Symbol RABGDIB RABGDIB HEL-S-46e
FamilyBelongs to the Rab GDI family.
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp450283GDI2GDP dissociation inhibitor 29598VGNC:3865OMA, EggNOG
Macaque712510GDI2GDP dissociation inhibitor 29544Inparanoid, OMA, EggNOG
Mouse14569Gdi2guanosine diphosphate (GDP) dissociation inhibitor 210090MGI:99845Inparanoid, OMA, EggNOG
Rat29662Gdi2GDP dissociation inhibitor 210116RGD:61802Inparanoid, OMA, EggNOG
Dog403818GDI2GDP dissociation inhibitor 29615VGNC:41165Inparanoid, OMA, EggNOG
Cow509832GDI2GDP dissociation inhibitor 29913VGNC:29308Inparanoid, OMA
Pig414427GDI2GDP dissociation inhibitor 29823Inparanoid, OMA
Opossum100022775GDI2GDP dissociation inhibitor 213616Inparanoid, OMA
PlatypusGDI2GDP dissociation inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:4227]9258OMA, EggNOG
Chicken395854GDI2GDP dissociation inhibitor 29031CGNC:49512Inparanoid, OMA
Anole lizard100553642gdi2GDP dissociation inhibitor 228377Inparanoid, OMA, EggNOG
Xenopus448175gdi2GDP dissociation inhibitor 28364XB-GENE-980621OMA, EggNOG
Zebrafish323765gdi2GDP dissociation inhibitor 27955ZDB-GENE-030131-2485Inparanoid, OMA
Fruitfly34264GdiGDP dissociation inhibitor7227FBgn0004868Inparanoid, EggNOG
S.cerevisiae856876GDI1Gdi1p4932S000000938Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein modulator    /    Rab GDP dissociation inhibitor beta
protein    /    enzyme modulator    /    acyltransferase    /    Rab GDP dissociation inhibitor beta
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acyltransferase    /    Rab GDP dissociation inhibitor beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.