224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | G protein-activated inward rectifier potassium channel 3 |
|---|
Gene and Protein Information
| Gene ID | 3765 |
|---|---|
| Uniprot Accession IDs | Q92806 Q5JW75 GIRK-3 |
| Ensembl ID | ENSP00000357067 |
| Symbol | GIRK3 GIRK3 KIR3.3 |
| Family | Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ9 subfamily. |
| Sequence | MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469548 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 9598 | VGNC:10678 | OMA, EggNOG |
| Mouse | 16524 | Kcnj9 | potassium inwardly-rectifying channel, subfamily J, member 9 | 10090 | MGI:108007 | Inparanoid, OMA, EggNOG |
| Rat | 116560 | Kcnj9 | potassium voltage-gated channel subfamily J member 9 | 10116 | RGD:621440 | Inparanoid, OMA, EggNOG |
| Dog | 100855823 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 9615 | VGNC:42269 | Inparanoid, OMA, EggNOG |
| Cow | 614969 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 9913 | VGNC:30464 | Inparanoid, OMA, EggNOG |
| Pig | 100152828 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 9823 | Inparanoid, OMA | |
| Opossum | 100029817 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100086093 | KCNJ9 | potassium voltage-gated channel subfamily J member 9 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100567687 | kcnj9 | potassium voltage-gated channel subfamily J member 9 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Ion channel / Inward rectifier-type potassium channel family / KCNJ9 subfamily / G protein-activated inward rectifier potassium channel 3
protein / Ion channel / Inward rectifier-type potassium channel family / KCNJ9 subfamily / G protein-activated inward rectifier potassium channel 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.