224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Creatine kinase M-type |
|---|
Gene and Protein Information
| Gene ID | 1158 |
|---|---|
| Uniprot Accession IDs | P06732 Q96QL9 |
| Ensembl ID | ENSP00000221476 |
| Symbol | CKMM CKMM M-CK CPK-M |
| Family | Belongs to the ATP:guanido phosphotransferase family. |
| Sequence | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744935 | CKM | creatine kinase, M-type | 9598 | VGNC:7552 | OMA, EggNOG |
| Mouse | 12715 | Ckm | creatine kinase, muscle | 10090 | MGI:88413 | Inparanoid, OMA, EggNOG |
| Rat | 24265 | Ckm | creatine kinase, M-type | 10116 | RGD:2358 | Inparanoid, OMA, EggNOG |
| Dog | 476435 | CKM | creatine kinase, M-type | 9615 | VGNC:39291 | Inparanoid, OMA |
| Horse | 100065641 | CKM | creatine kinase, M-type | 9796 | VGNC:16564 | Inparanoid, OMA |
| Cow | 286822 | CKM | creatine kinase, M-type | 9913 | VGNC:27385 | Inparanoid, OMA |
| Xenopus | 395005 | ckm | creatine kinase, M-type | 8364 | XB-GENE-493628 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.