224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone H2A type 1-B/E |
|---|
Gene and Protein Information
| Gene ID | 3012 |
|---|---|
| Uniprot Accession IDs | P04908 P28001 Q76P63 |
| Ensembl ID | ENSP00000483842 |
| Symbol | H2AFM H2A.1 H2A.2 H2A/a H2AFA |
| Family | Belongs to the histone H2A family. |
| Sequence | MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 319172 | Hist1h2ab | histone cluster 1, H2ab | 10090 | MGI:2448306 | Inparanoid, OMA |
| Rat | 502129 | hist1h2ail2 | histone cluster 1, H2ai-like2 | 10116 | RGD:1562827 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.