🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

HIST2H2AB

DescriptionHistone H2A type 2-B

Gene and Protein Information

Gene ID317772
Uniprot Accession IDs Q8IUE6
Ensembl ID ENSP00000332790
Symbol H2AB
FamilyBelongs to the histone H2A family.
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque705170HIST2H2ABhistone cluster 2, H2ab9544Inparanoid, EggNOG
Mouse621893Hist2h2abhistone cluster 2, H2ab10090MGI:2448314Inparanoid, OMA, EggNOG
Rat690102Hist2h2abhistone cluster 2 H2A family member b10116RGD:1584064Inparanoid, OMA, EggNOG
Horse106783189LOC106783189histone H2A type 2-B9796OMA, EggNOG
Cow614974HIST2H2ABhistone cluster 2, H2ab9913Inparanoid, OMA, EggNOG
Pig100154181LOC100154181histone H2A type 2-B9823Inparanoid, EggNOG
Opossum100013915LOC100013915histone H2A type 2-B13616OMA, EggNOG
Anole lizard100557242LOC100557242histone H2A type 2-C-like28377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    histone    /    Histone H2A type 2-B
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Histone    /    Histone H2A type 2-B

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.