224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone H1.3 |
|---|
Gene and Protein Information
| Gene ID | 3007 |
|---|---|
| Uniprot Accession IDs | P16402 B2R751 Q2M2I2 |
| Ensembl ID | ENSP00000244534 |
| Symbol | H1F3 H1D H1.3 H1F3 H1s-2 |
| Family | Belongs to the histone H1/H5 family. |
| Sequence | MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 472227 | HIST1H1D | histone cluster 1 H1 family member d | 9598 | VGNC:14368 | OMA, EggNOG |
| Macaque | 698238 | HIST1H1D | histone cluster 1, H1d | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14957 | Hist1h1d | histone cluster 1, H1d | 10090 | MGI:107502 | Inparanoid, EggNOG |
| Cow | 509275 | HIST1H1D | histone cluster 1, H1d | 9913 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.