224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone H2A type 1-A |
|---|
Gene and Protein Information
| Gene ID | 221613 |
|---|---|
| Uniprot Accession IDs | Q96QV6 |
| Ensembl ID | ENSP00000297012 |
| Symbol | H2AFR H2AA TH2A H2AFR bA317E16.2 |
| Family | Belongs to the histone H2A family. |
| Sequence | MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462486 | HIST1H2AA | histone cluster 1 H2A family member a | 9598 | VGNC:14358 | OMA, EggNOG |
| Dog | 488251 | HIST1H2AA | histone cluster 1, H2aa | 9615 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.