224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Histone H2A type 2-C |
|---|
Gene and Protein Information
| Gene ID | 8338 |
|---|---|
| Uniprot Accession IDs | Q16777 Q6DRA7 Q8IUE5 |
| Ensembl ID | ENSP00000332194 |
| Symbol | H2AFQ H2A H2A/q H2AFQ H2A-GL101 |
| Family | Belongs to the histone H2A family. |
| Sequence | MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Rat | 499675 | Hist2h2ac | histone cluster 2 H2A family member c | 10116 | RGD:1560965 | Inparanoid, OMA |
| Anole lizard | 100557637 | LOC100557637 | histone H2A type 2-C | 28377 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.