🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GK

DescriptionGlycerol kinase

Gene and Protein Information

Gene ID2710
Uniprot Accession IDs P32189 A6NJP5 B2R833 Q6IQ27 Q8IVR5 Q9UMP0 Q9UMP1 GK
Ensembl ID ENSP00000401720
Symbol GK1 GKD
FamilyBelongs to the FGGY kinase family.
Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Mouse14933Gkglycerol kinase10090MGI:106594Inparanoid, OMA, EggNOG
Horse100051016GKglycerol kinase9796OMA, EggNOG
Cow505987GKglycerol kinase9913OMA, EggNOG
Pig100233182GKglycerol kinase9823OMA, EggNOG
Chicken418589GKglycerol kinase9031CGNC:50798OMA, EggNOG
Anole lizard100558273gkglycerol kinase28377OMA, EggNOG
Xenopus100038285gkglycerol kinase8364XB-GENE-961541OMA, EggNOG
Zebrafish100136866zgc:172295zgc:1722957955ZDB-GENE-080204-72OMA, EggNOG
C. elegans173747R11F4.1Probable glycerol kinase6239OMA, EggNOG
S.cerevisiae856353GUT1glycerol kinase4932S000001024Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.