🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GALNT2

DescriptionPolypeptide N-acetylgalactosaminyltransferase 2

Gene and Protein Information

Gene ID2590
Uniprot Accession IDs Q10471 A8K1Y3 B7Z8V8 C5HU00 Q9NPY4
Ensembl ID ENSP00000355632
Symbol GalNAc-T2
FamilyBelongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
Sequence
MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457808GALNT2polypeptide N-acetylgalactosaminyltransferase 29598VGNC:11437OMA, EggNOG
Macaque714371GALNT2polypeptide N-acetylgalactosaminyltransferase 29544Inparanoid, OMA, EggNOG
Mouse108148Galnt2polypeptide N-acetylgalactosaminyltransferase 210090MGI:894694Inparanoid, OMA
Rat292090Galnt2polypeptide N-acetylgalactosaminyltransferase 210116RGD:1310692Inparanoid, OMA
Dog100682763GALNT2polypeptide N-acetylgalactosaminyltransferase 29615VGNC:41094Inparanoid, OMA, EggNOG
Horse100065695GALNT2polypeptide N-acetylgalactosaminyltransferase 29796VGNC:18232Inparanoid, OMA, EggNOG
Cow616218GALNT2polypeptide N-acetylgalactosaminyltransferase 29913VGNC:29231Inparanoid, OMA, EggNOG
Pig100153028GALNT2polypeptide N-acetylgalactosaminyltransferase 29823Inparanoid, OMA, EggNOG
Opossum100022258GALNT2polypeptide N-acetylgalactosaminyltransferase 213616Inparanoid, OMA, EggNOG
PlatypusGALNT2polypeptide N-acetylgalactosaminyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:4124]9258OMA, EggNOG
Chicken421540GALNT2polypeptide N-acetylgalactosaminyltransferase 29031CGNC:8433Inparanoid, OMA, EggNOG
Anole lizard100567307galnt2polypeptide N-acetylgalactosaminyltransferase 228377Inparanoid, OMA, EggNOG
Xenopusgalnt2polypeptide N-acetylgalactosaminyltransferase 2 [Source:Xenbase;Acc:XB-GENE-980077]8364OMA, EggNOG
Zebrafish570248galnt2UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 27955ZDB-GENE-041111-110Inparanoid, OMA
C. elegans180302gly-4GLYcosylation related6239OMA, EggNOG
Fruitfly33556pgant2polypeptide GalNAc transferase 27227FBgn0031530Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    glycosyltransferase    /    Polypeptide N-acetylgalactosaminyltransferase 2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Glycosyltransferase    /    Polypeptide N-acetylgalactosaminyltransferase 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.