GPR143

DescriptionG-protein coupled receptor 143

Gene and Protein Information

Gene ID4935
Uniprot Accession IDs P51810 Q6NTI7
Ensembl ID ENSP00000417161
Symbol OA1 OA1 NYS6
FamilyBelongs to the G-protein coupled receptor OA family.
Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque709148GPR143G protein-coupled receptor 1439544Inparanoid, OMA, EggNOG
Mouse18241Gpr143G protein-coupled receptor 14310090MGI:107193Inparanoid, OMA, EggNOG
Rat302619Gpr143G protein-coupled receptor 14310116RGD:1565799Inparanoid, OMA, EggNOG
Horse100147328GPR143G protein-coupled receptor 1439796VGNC:18515Inparanoid, OMA, EggNOG
Cow613505GPR143G protein-coupled receptor 1439913Inparanoid, OMA, EggNOG
Opossum100032098GPR143G protein-coupled receptor 14313616Inparanoid, OMA, EggNOG
Chicken418652GPR143G protein-coupled receptor 1439031CGNC:12450Inparanoid, OMA, EggNOG
Anole lizard100555530gpr143G protein-coupled receptor 14328377Inparanoid, OMA, EggNOG
Xenopus496427gpr143G protein-coupled receptor 1438364XB-GENE-5848649Inparanoid, OMA, EggNOG
Zebrafish393795gpr143G protein-coupled receptor 1437955ZDB-GENE-040426-1476Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Other 7TM proteins    /    G-protein coupled receptor 143

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.