🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

GPR182

DescriptionG-protein coupled receptor 182

Gene and Protein Information

Gene ID11318
Uniprot Accession IDs O15218
Ensembl ID ENSP00000300098
Symbol ADMR AMR 7TMR ADMR AM-R G10D L1-R gamrh hrhAMR
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100610034GPR182G protein-coupled receptor 1829598VGNC:13095Inparanoid, OMA, EggNOG
Macaque713866GPR182G protein-coupled receptor 1829544Inparanoid, OMA, EggNOG
Mouse11536Gpr182G protein-coupled receptor 18210090MGI:109545Inparanoid, OMA, EggNOG
Rat29307Gpr182G protein-coupled receptor 18210116RGD:61903Inparanoid, OMA, EggNOG
Dog481120GPR182G protein-coupled receptor 1829615VGNC:41422Inparanoid, OMA, EggNOG
Horse100052618GPR182G protein-coupled receptor 1829796VGNC:18533Inparanoid, OMA, EggNOG
Cow509554GPR182G protein-coupled receptor 1829913VGNC:29576Inparanoid, OMA, EggNOG
Opossum100011340GPR182G protein-coupled receptor 18213616Inparanoid, OMA, EggNOG
Anole lizard100559839gpr182G protein-coupled receptor 18228377Inparanoid, OMA, EggNOG
Xenopus100498373gpr182G protein-coupled receptor 1828364XB-GENE-957938Inparanoid, OMA, EggNOG
Zebrafish323641gpr182G protein-coupled receptor 1827955ZDB-GENE-030131-2361Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 182
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Adrenomedullin receptor    /    G-protein coupled receptor 182

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.