🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

INMT

DescriptionIndolethylamine N-methyltransferase

Gene and Protein Information

Gene ID11185
Uniprot Accession IDs O95050 B8ZZ69 Q3KP49 Q9P1Y2 Q9UBY4 Q9UHQ0 Indolamine N-methyltransferase
Ensembl ID ENSP00000013222
Symbol TEMT
FamilyBelongs to the class I-like SAM-binding methyltransferase superfamily. NNMT/PNMT/TEMT family.
Sequence
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp463912INMTindolethylamine N-methyltransferase9598OMA, EggNOG
Mouse21743Inmtindolethylamine N-methyltransferase10090MGI:102963Inparanoid, OMA, EggNOG
Rat368066Inmtindolethylamine N-methyltransferase10116RGD:1597087Inparanoid, OMA, EggNOG
Horse100055070INMTindolethylamine N-methyltransferase9796Inparanoid, OMA, EggNOG
Cow527922INMTindolethylamine N-methyltransferase9913Inparanoid, EggNOG
Xenopus100145174loc100145174uncharacterized LOC1001451748364XB-GENE-5789558OMA, EggNOG
Xenopus548447MGC107884MGC107884 protein8364XB-GENE-5767840Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transferase    /    methyltransferase    /    Indolethylamine N-methyltransferase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Methyltransferase    /    Indolethylamine N-methyltransferase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.