🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CETN3

DescriptionCentrin-3

Gene and Protein Information

Gene ID1070
Uniprot Accession IDs O15182 Q53YD2 Q9BS23
Ensembl ID ENSP00000428259
Symbol CEN3 CEN3 CDC31
FamilyBelongs to the centrin family.
Sequence
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp738363CETN3centrin 39598VGNC:3949OMA, EggNOG
Macaque695223CETN3centrin 39544Inparanoid, OMA, EggNOG
Mouse12626Cetn3centrin 310090MGI:1097706Inparanoid, OMA, EggNOG
Rat170895Cetn3centrin 310116RGD:620249Inparanoid, OMA
Rat100912538LOC100912538centrin-3-like10116RGD:6486167OMA, EggNOG
Dog488915CETN3centrin 39615VGNC:39156Inparanoid, OMA, EggNOG
Horse100065122CETN3centrin 39796VGNC:16448Inparanoid, OMA, EggNOG
Cow532953CETN3centrin 39913VGNC:27235Inparanoid, OMA, EggNOG
Pig574052CETN3centrin 39823Inparanoid, OMA, EggNOG
Opossum100011142CETN3centrin 313616Inparanoid, OMA, EggNOG
Platypus100079208CETN3centrin 39258Inparanoid, OMA, EggNOG
Chicken427104CETN3centrin 39031CGNC:10857Inparanoid, OMA, EggNOG
Anole lizard100552719cetn3centrin 328377OMA, EggNOG
Xenopus549141cetn3centrin 38364XB-GENE-1001054Inparanoid, OMA, EggNOG
Zebrafish552931cetn3centrin 37955ZDB-GENE-050522-152Inparanoid, OMA, EggNOG
S.cerevisiae854431CDC31centrin4932S000005783Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Centrin-3
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Centrin-3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.