INHA

DescriptionInhibin alpha chain

Gene and Protein Information

Gene ID3623
Uniprot Accession IDs P05111 A8K8H5
Ensembl ID ENSP00000243786
FamilyBelongs to the TGF-beta family.
Sequence
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743866INHAinhibin subunit alpha9598VGNC:1976OMA, EggNOG
Macaque574379INHAinhibin alpha subunit9544Inparanoid, OMA, EggNOG
Mouse16322Inhainhibin alpha10090MGI:96569Inparanoid, OMA, EggNOG
Rat24504Inhainhibin alpha subunit10116RGD:2912Inparanoid, OMA, EggNOG
Dog488540INHAinhibin subunit alpha9615VGNC:42020Inparanoid, OMA, EggNOG
Horse100034077INHAinhibin alpha9796Inparanoid, EggNOG
Cow281254INHAinhibin subunit alpha9913VGNC:30199Inparanoid, OMA, EggNOG
Pig397386INHAinhibin alpha subunit9823Inparanoid, OMA, EggNOG
Opossum100009806INHAinhibin alpha subunit13616Inparanoid, OMA, EggNOG
Chicken424197INHAinhibin alpha subunit9031CGNC:8534Inparanoid, OMA, EggNOG
Anole lizard100561289inhainhibin alpha subunit28377Inparanoid, OMA, EggNOG
Xenopus613114inhainhibin subunit alpha8364XB-GENE-853910Inparanoid, OMA, EggNOG
Zebrafish570520inhainhibin subunit alpha7955ZDB-GENE-060503-554Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Inhibin alpha chain
DTO Classes
protein    /    Signaling    /    Growth factor    /    Inhibin alpha chain

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.