🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IVL

DescriptionInvolucrin

Gene and Protein Information

Gene ID3713
Uniprot Accession IDs P07476 Q5T7P4
Ensembl ID ENSP00000357753
FamilyBelongs to the involucrin family.
Sequence
MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp736637IVLinvolucrin9598VGNC:53230OMA, EggNOG
Mouse16447Ivlinvolucrin10090MGI:96626Inparanoid, OMA, EggNOG
Rat60583Ivlinvolucrin10116RGD:620141Inparanoid, OMA, EggNOG
Cow280830IVLinvolucrin9913Inparanoid, OMA, EggNOG
Pig407242IVLinvolucrin9823Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.