IRF1

DescriptionInterferon regulatory factor 1

Gene and Protein Information

Gene ID3659
Uniprot Accession IDs P10914 Q96GG7 IRF-1
Ensembl ID ENSP00000245414
Symbol MAR IRF-1
FamilyBelongs to the IRF family.
Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp107974852IRF1interferon regulatory factor 19598VGNC:4049OMA, EggNOG
Macaque707788IRF1interferon regulatory factor 19544Inparanoid, OMA, EggNOG
Mouse16362Irf1interferon regulatory factor 110090MGI:96590Inparanoid, OMA, EggNOG
Rat24508Irf1interferon regulatory factor 110116RGD:2920Inparanoid, OMA, EggNOG
Dog100855872IRF1interferon regulatory factor 19615VGNC:42091Inparanoid, OMA, EggNOG
Horse100063253IRF1interferon regulatory factor 19796VGNC:19130Inparanoid, OMA, EggNOG
Cow789216IRF1interferon regulatory factor 19913VGNC:30270Inparanoid, OMA, EggNOG
Pig396611IRF1interferon regulatory factor 19823Inparanoid, OMA, EggNOG
Opossum100018712IRF1interferon regulatory factor 113616Inparanoid, EggNOG
PlatypusIRF1interferon regulatory factor 1 [Source:HGNC Symbol;Acc:HGNC:6116]9258OMA, EggNOG
Chicken396384IRF1interferon regulatory factor 19031CGNC:5120Inparanoid, OMA, EggNOG
Anole lizard100566668irf1interferon regulatory factor 128377Inparanoid, OMA, EggNOG
Xenopus448320irf1interferon regulatory factor 18364XB-GENE-942994Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.