🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

IRF2

DescriptionInterferon regulatory factor 2

Gene and Protein Information

Gene ID3660
Uniprot Accession IDs P14316 D6RCK5 H0Y8S3 Q6IAS7 Q96B99 IRF-2
Ensembl ID ENSP00000377218
Symbol IRF-2
FamilyBelongs to the IRF family.
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque694347IRF2interferon regulatory factor 29544Inparanoid, OMA, EggNOG
Mouse16363Irf2interferon regulatory factor 210090MGI:96591Inparanoid, OMA, EggNOG
Rat290749Irf2interferon regulatory factor 210116RGD:1304922Inparanoid, OMA, EggNOG
Dog475633IRF2interferon regulatory factor 29615VGNC:42092Inparanoid, OMA, EggNOG
Horse100050990IRF2interferon regulatory factor 29796VGNC:19131Inparanoid, OMA, EggNOG
Cow337916IRF2interferon regulatory factor 29913VGNC:30271Inparanoid, OMA, EggNOG
Pig100621620IRF2interferon regulatory factor 29823Inparanoid, OMA, EggNOG
Opossum100012282IRF2interferon regulatory factor 213616Inparanoid, OMA, EggNOG
Chicken396115IRF2interferon regulatory factor 29031CGNC:8084Inparanoid, OMA
Anole lizard100559594irf2interferon regulatory factor 228377Inparanoid, OMA, EggNOG
Xenopus493376irf2interferon regulatory factor 28364XB-GENE-942910Inparanoid, OMA, EggNOG
Zebrafish494071irf2interferon regulatory factor 27955ZDB-GENE-041212-38OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.