224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Glutathione S-transferase omega-1 |
|---|
Gene and Protein Information
| Gene ID | 9446 |
|---|---|
| Uniprot Accession IDs | P78417 D3DRA3 F5H7H0 Q5TA03 Q7Z3T2 GSTO-1 |
| Ensembl ID | ENSP00000358727 |
| Symbol | GSTTLP28 P28 SPG-R GSTO 1-1 GSTTLp28 HEL-S-21 |
| Family | Belongs to the GST superfamily. Omega family. |
| Sequence | MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450719 | GSTO1 | glutathione S-transferase omega 1 | 9598 | VGNC:12340 | Inparanoid, OMA, EggNOG |
| Macaque | 716078 | GSTO1 | glutathione S-transferase omega 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14873 | Gsto1 | glutathione S-transferase omega 1 | 10090 | MGI:1342273 | Inparanoid, OMA, EggNOG |
| Rat | 114846 | Gsto1 | glutathione S-transferase omega 1 | 10116 | RGD:70952 | Inparanoid, OMA, EggNOG |
| Dog | 477813 | GSTO1 | glutathione S-transferase omega 1 | 9615 | VGNC:41536 | Inparanoid, OMA |
| Horse | 100069640 | GSTO1 | glutathione S-transferase omega 1 | 9796 | VGNC:18628 | Inparanoid, OMA |
| Cow | 785216 | GSTO1 | glutathione S-transferase omega 1 | 9913 | Inparanoid, OMA | |
| Pig | 397117 | GSTO1 | glutathione S-transferase omega 1 | 9823 | Inparanoid, OMA | |
| Chicken | 423881 | GSTO1 | glutathione S-transferase omega 1 | 9031 | CGNC:52072 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.