224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Glutathione S-transferase kappa 1 |
|---|
Gene and Protein Information
| Gene ID | 373156 |
|---|---|
| Uniprot Accession IDs | Q9Y2Q3 B4DIH1 B4DSY2 Q6P4H0 Q7Z520 Q9P1S4 |
| Ensembl ID | ENSP00000431049 |
| Symbol | GST GST13 hGSTK1 GSTK1-1 GST13-13 GST 13-13 |
| Family | Belongs to the GST superfamily. Kappa family. |
| Sequence | MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463802 | GSTK1 | glutathione S-transferase kappa 1 | 9598 | VGNC:4382 | Inparanoid, OMA, EggNOG |
| Macaque | 704240 | GSTK1 | glutathione S-transferase kappa 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 76263 | Gstk1 | glutathione S-transferase kappa 1 | 10090 | MGI:1923513 | Inparanoid, OMA, EggNOG |
| Rat | 297029 | Gstk1 | glutathione S-transferase kappa 1 | 10116 | RGD:735188 | Inparanoid, OMA, EggNOG |
| Dog | 475518 | GSTK1 | glutathione S-transferase kappa 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100056014 | GSTK1 | glutathione S-transferase kappa 1 | 9796 | VGNC:18626 | Inparanoid, OMA, EggNOG |
| Cow | 613498 | GSTK1 | glutathione S-transferase kappa 1 | 9913 | VGNC:29685 | Inparanoid, OMA, EggNOG |
| Opossum | 100011709 | GSTK1 | glutathione S-transferase kappa 1 | 13616 | OMA, EggNOG | |
| Chicken | 418302 | GSTK1 | glutathione S-transferase kappa 1 | 9031 | CGNC:10904 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563685 | gstk1 | glutathione S-transferase kappa 1 | 28377 | OMA, EggNOG | |
| Zebrafish | 436833 | gstk1 | glutathione S-transferase kappa 1 | 7955 | ZDB-GENE-040718-298 | OMA, EggNOG |
| C. elegans | 191563 | gstk-1 | Glutathione S-transferase kappa 1 | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.