224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Glutathione S-transferase Mu 2 |
|---|
Gene and Protein Information
| Gene ID | 2946 |
|---|---|
| Uniprot Accession IDs | P28161 B4DRY4 E9PEM9 Q2M318 Q5TZY5 Q8WWE1 |
| Ensembl ID | ENSP00000241337 |
| Symbol | GST4 GST4 GSTM GTHMUS GSTM2-2 |
| Family | Belongs to the GST superfamily. Mu family. |
| Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 68312 | Gstm7 | glutathione S-transferase, mu 7 | 10090 | MGI:1915562 | Inparanoid, OMA |
| Mouse | 14863 | Gstm2 | glutathione S-transferase, mu 2 | 10090 | MGI:95861 | OMA, EggNOG |
| Horse | 100058329 | LOC100058329 | glutathione S-transferase Mu 1-like | 9796 | OMA, EggNOG | |
| Xenopus | 448387 | gstm1 | glutathione S-transferase mu 1 | 8364 | XB-GENE-971384 | OMA, EggNOG |
| Zebrafish | 568744 | gstm.3 | glutathione S-transferase mu tandem duplicate 3 | 7955 | ZDB-GENE-050309-24 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.