224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Glycine N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 27232 |
|---|---|
| Uniprot Accession IDs | Q14749 Q5T8W2 Q9NNZ1 Q9NS24 |
| Ensembl ID | ENSP00000361894 |
| Symbol | HEL-S-182mP |
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. Glycine N-methyltransferase family. |
| Sequence | MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 462703 | GNMT | glycine N-methyltransferase | 9598 | VGNC:2847 | OMA, EggNOG |
| Macaque | 697722 | GNMT | glycine N-methyltransferase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14711 | Gnmt | glycine N-methyltransferase | 10090 | MGI:1202304 | Inparanoid, OMA, EggNOG |
| Rat | 25134 | Gnmt | glycine N-methyltransferase | 10116 | RGD:2719 | OMA, EggNOG |
| Rat | 100911564 | LOC100911564 | glycine N-methyltransferase-like | 10116 | RGD:6491825 | Inparanoid, OMA |
| Dog | 474905 | GNMT | glycine N-methyltransferase | 9615 | VGNC:41329 | Inparanoid, OMA, EggNOG |
| Horse | 100067145 | GNMT | glycine N-methyltransferase | 9796 | VGNC:18442 | Inparanoid, OMA, EggNOG |
| Cow | 538212 | GNMT | glycine N-methyltransferase | 9913 | VGNC:29475 | Inparanoid, OMA, EggNOG |
| Opossum | 100010632 | GNMT | glycine N-methyltransferase | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100552842 | gnmt | glycine N-methyltransferase | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 403338 | gnmt | glycine N-methyltransferase | 7955 | ZDB-GENE-040227-1 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.